PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_007177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 432aa    MW: 47543.9 Da    PI: 6.9119
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_007177genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.21.5e-32210266259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  dDgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkk ver+  d++v+ei+Y+g+Hnh+
  DCAR_007177 210 DDGYNWRKYGQKHVKGSEYPRSYYKCTHSNCPVKKIVERAL-DGQVTEIVYKGQHNHQ 266
                  8****************************************.***************8 PP

2WRKY35.81.6e-11384406123
                  ---SS-EEEEEEE--TT-SS-EE CS
         WRKY   1 ldDgynWrKYGqKevkgsefprs 23 
                  ldDg++WrKYGqK+vkg+++pr 
  DCAR_007177 384 LDDGFRWRKYGQKVVKGNPYPRF 406
                  59*******************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.5E-29202268IPR003657WRKY domain
SuperFamilySSF1182904.05E-26207268IPR003657WRKY domain
SMARTSM007745.4E-36209267IPR003657WRKY domain
PfamPF031061.6E-25210266IPR003657WRKY domain
PROSITE profilePS5081123.72210268IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.8E-13369408IPR003657WRKY domain
SuperFamilySSF1182905.75E-10376408IPR003657WRKY domain
PROSITE profilePS5081115.594379408IPR003657WRKY domain
SMARTSM007742.0E-4384420IPR003657WRKY domain
PfamPF031061.5E-7385408IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MDKNEESTSI RRPMLNLPPR SSVENLFTGA STVSPGPMTL VSSFFSENDP DSDCRSFSQL  60
LAGAVEAPVA ADDSGGDLRF KMNRPSGLAV TQPSMFTIPP GLSPACLLDS PGLFSANQGA  120
FGTSHQQALA QVTVQALQSH SQPQNQLEYP SLAAPAVSFP QFTASVSTTS AYQQMLTSVP  180
DRSLVKQSSQ LSQSDMRSQP SSLTVDKPAD DGYNWRKYGQ KHVKGSEYPR SYYKCTHSNC  240
PVKKIVERAL DGQVTEIVYK GQHNHQRPQS NKRGKDAGNE SLSFHHDTRL VSEHQTGNLN  300
DERSGYPLSV KDQELSLATH EQLSGSSDSE EVADSKTRVF ERNEDEPEAK RRPTDVRVIE  360
SAASHRTVTE PRIVVQTTSE VDLLDDGFRW RKYGQKVVKG NPYPRFGYII NASYSLILPG  420
IVRDFKLNLV M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-17210421877Probable WRKY transcription factor 4
2lex_A3e-17210421877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5964669e-38AY596466.2 Vitis vinifera DNA binding protein WRKY2 (WRKY2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794188.11e-168PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-133WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A068TVV41e-174A0A068TVV4_COFCA; Uncharacterized protein
STRINGVIT_01s0011g00220.t011e-165(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41072445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-123WRKY DNA-binding protein 4